DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and LOC691030

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_008771758.1 Gene:LOC691030 / 691030 RGDID:1588662 Length:168 Species:Rattus norvegicus


Alignment Length:161 Identity:56/161 - (34%)
Similarity:94/161 - (58%) Gaps:8/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            :|:..::.|.:|:...|.:.:::.|:....|.||||||:|:|||:..||||::..:|::||.||:
  Rat     8 RPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQ 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:||..|:     |.::|   :|.:||::..|:|..|..|..:::|..:|.:.||.:||..||
  Rat    73 REMRNYSGPR-----RERRR---RDADAPRKPPSSFLLFSQDHFDEIKEQHPNWTVGQVAKAAGR 129

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEY 342
            .|:......|..||..|...:|:|..|...|
  Rat   130 MWARCSEADKIPYEERAAVLRAKYLEEREAY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 27/69 (39%)
HMGB-UBF_HMG-box 275..339 CDD:238686 20/63 (32%)
LOC691030XP_008771758.1 HMGB-UBF_HMG-box 9..76 CDD:238686 26/66 (39%)
HMGB-UBF_HMG-box 95..158 CDD:238686 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.