DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Hmgb4

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001102933.1 Gene:Hmgb4 / 685271 RGDID:1596426 Length:181 Species:Rattus norvegicus


Alignment Length:184 Identity:65/184 - (35%)
Similarity:103/184 - (55%) Gaps:19/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 KADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDK 242
            |...:|:..:::|.:|:...|.:.|::.|:..:.|.||||:|:|:|:::...||.:|..:|:.||
  Rat     4 KVQLRPKVNVSSYIHFMINFRNKFKEQQPNTYLTFNEFSRRCSEKWRSISKNEKAKFEAIAKLDK 68

  Fly   243 QRYEAEMQNYVPPKGAVVGRGKKRKQIK-DPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIA 306
            .||:.||.|||         ||:||:.| ||.||::..|:|..|..|...|:|..||.:.|..:|
  Rat    69 ARYQEEMMNYV---------GKRRKRRKRDPLAPRKPPSSFLLFSLDHFAKLKQENPNWTVVQVA 124

  Fly   307 KELGRKWS---DVDPEVKQKYESMAERDKARYEREMTEYKT---SGKIAMSAPS 354
            |..|:.||   |||   |:.||..|...:|:|.:|...|.:   :.||.:...|
  Rat   125 KAAGKMWSMITDVD---KRPYEQKAAIMRAKYFQEREAYLSQCQNSKINLQGSS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 24/69 (35%)
HMGB-UBF_HMG-box 275..339 CDD:238686 24/66 (36%)
Hmgb4NP_001102933.1 HMGB-UBF_HMG-box 9..75 CDD:238686 22/65 (34%)
HMG-box 93..158 CDD:238037 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.