DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Hmg1l1

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001102843.1 Gene:Hmg1l1 / 679571 RGDID:1587112 Length:214 Species:Rattus norvegicus


Alignment Length:218 Identity:101/218 - (46%)
Similarity:144/218 - (66%) Gaps:15/218 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|::||:|||||||||||||||.:|.|:|||:||:||||||..|||.:|.:||:.||.|||
  Rat     8 KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYE 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:.|:|||      |:.:|:.||||||||..||||.||::.|.|:|..:|...:||:||:||.
  Rat    73 REMKTYIPPK------GETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAA----A 372
            .|::...:.||.||..|.:.|.:||:::..|:..||     |........:|:|:.....    .
  Rat   132 MWNNTAADDKQPYEKKAAKLKEKYEKDIPAYRAKGK-----PDAAKKGVVKAEKSKKKKEEEDNE 191

  Fly   373 AQQQHQQLEEQHDDDDGDGDDDE 395
            ..::.::.||:.:|:|.:.||||
  Rat   192 EDEEDEEEEEEEEDEDEEDDDDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 48/69 (70%)
HMGB-UBF_HMG-box 275..339 CDD:238686 28/63 (44%)
Hmg1l1NP_001102843.1 HMG_box_2 7..78 CDD:286146 48/69 (70%)
HMG_box 95..162 CDD:278906 28/66 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5799
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3551
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm45117
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.