DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and UBTFL1

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001137447.1 Gene:UBTFL1 / 642623 HGNCID:14533 Length:393 Species:Homo sapiens


Alignment Length:259 Identity:44/259 - (16%)
Similarity:94/259 - (36%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 QLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMS---------------------- 175
            :|..|.:|:..|..::::|..:::..:.:::..:::..|...|                      
Human   140 ELPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKKSSVSKRTQNKVQKKFQKNIEEVRS 204

  Fly   176 ---------RVKADAKP-RGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKE 230
                     :||...:| :..|..|..|.|......:.:|........|..|    ||:.:...:
Human   205 LPKTDRFFKKVKFHGEPQKPPMNGYHKFHQDSWSSKEMQHLSVRERMVEIGR----RWQRIPQSQ 265

  Fly   231 KKRFHEMAEKDKQRYEAEM---------QNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFC 286
            |..|...||:.:::|:.::         :||...|.:...:||.......|:...:.       .
Human   266 KDHFKSQAEELQKQYKVKLDLWLKTLSPENYAAYKESTYAKGKNMAMTGGPDPRLKQ-------A 323

  Fly   287 NDERNKVKALNPEFGVGDIAKELGRKWSD---VDPEVKQKYESMAERDKARYEREMTEYKTSGK 347
            :.:.:..|.|...||.|...:..|...|.   |:..|..:.|...::|:.:.|...:...:||:
Human   324 DPQSSSAKGLQEGFGEGQGLQAAGTDSSQTIWVNCHVSMEPEENRKKDREKEESSNSSDCSSGE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 15/79 (19%)
HMGB-UBF_HMG-box 275..339 CDD:238686 12/66 (18%)
UBTFL1NP_001137447.1 HMGB-UBF_HMG-box 100..165 CDD:238686 5/24 (21%)
HMGB-UBF_HMG-box 223..285 CDD:238686 14/65 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..393 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.