DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and tfam

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001070857.1 Gene:tfam / 571106 ZFINID:ZDB-GENE-061013-552 Length:277 Species:Danio rerio


Alignment Length:216 Identity:49/216 - (22%)
Similarity:98/216 - (45%) Gaps:29/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 INSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKK 232
            |.|.|..:|    ..|:..:|||..||:..:....|::|  ::...:..||.|::||.:..::|:
Zfish    36 IKSFSTATR----GPPKRPLTAYMTFVKDMQPTVSKQNP--SIKSVDVMRKIAQQWKMLTTEQKQ 94

  Fly   233 RFHEMAEKDKQRYEAEMQNY----VPPKGAVVGRGK-----------KRKQIKDPNAPKRSLSAF 282
            .|...:.:.|::|:..::.:    .|.:.|.....|           |:|::.:...|||..|.|
Zfish    95 PFQVASLEAKEQYKLALEKFKAQLTPAESAAFAEEKRQRVAKRKAIRKKKELNNLGKPKRPRSTF 159

  Fly   283 FWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTS-- 345
            ..|..:...:.|....:..:    |.|...|:.:....||.|..:||.||.||:.|:..::..  
Zfish   160 NIFMAEHFVEAKGTTTQAKL----KSLRDDWNRLSDTQKQMYIQLAEDDKVRYKNEIKSWEEHMM 220

  Fly   346 --GKIAMSAPSMQASMQAQAQ 364
              |:..:.....:::::|:|:
Zfish   221 EIGREDLLRRKTKSALKAKAK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 17/69 (25%)
HMGB-UBF_HMG-box 275..339 CDD:238686 19/63 (30%)
tfamNP_001070857.1 HMG_box 47..114 CDD:278906 17/68 (25%)
HMGB-UBF_HMG-box 152..213 CDD:238686 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.