DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmgb3a

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001116308.1 Gene:hmgb3a / 561025 ZFINID:ZDB-GENE-050428-1 Length:213 Species:Danio rerio


Alignment Length:215 Identity:96/215 - (44%)
Similarity:138/215 - (64%) Gaps:10/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||:|:|:||||||||||||||||.|:..|.|:|||::|:.|||.|.||||.||.:||::||.||:
Zfish     8 KPKGKMSAYAYFVQTCREEHKKKSPEIPVSFSEFSKRCSGRWKAMTDKEKSRFEDMAKQDKVRYD 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||.:|:|.|     ||||    ||||||||..|.||.||::.|.::||..|..|:||:||:||.
Zfish    73 QEMMHYMPGK-----RGKK----KDPNAPKRPPSGFFLFCSEHRPQIKAQYPSLGIGDVAKKLGE 128

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASM-QAQAQKAALLAAAAQQ 375
            .|:.:....||.:...|.:.|.:|::::.:|||..|....:..|...| .....|..:.:....:
Zfish   129 MWNGLTDANKQPFLMKANKLKDKYQKDVADYKTKSKAGGVSMGMGMPMANCMPPKPMMKSNMDDE 193

  Fly   376 QHQQLEEQHDDDDGDGDDDE 395
            :..:.:|:.::||.:.||||
Zfish   194 EDDEEDEEEEEDDDEYDDDE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 45/69 (65%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)
hmgb3aNP_001116308.1 HMG_box_2 7..78 CDD:286146 45/69 (65%)
HMG_box 92..159 CDD:278906 25/66 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583917
Domainoid 1 1.000 117 1.000 Domainoid score I5857
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3548
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm24274
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.