DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and tox4a

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001921001.2 Gene:tox4a / 559853 ZFINID:ZDB-GENE-070912-576 Length:685 Species:Danio rerio


Alignment Length:373 Identity:78/373 - (20%)
Similarity:135/373 - (36%) Gaps:107/373 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SSNTTAGVGTQQLFTYKMASSFPNPAT---------TMAQVVATSNAAGTTGYDYRLNMAQAAAA 108
            :|||..| |....|    ||:|.||::         .|.|...::..:.|.|.|...::....|:
Zfish   109 ASNTVVG-GNDPSF----ASTFMNPSSQGMEHLTLGVMNQQGGSALLSSTLGVDLGHSVGSHFAS 168

  Fly   109 AA-----VPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVI 168
            ::     ||.::..:|.....|:.....:.|                    ..|:.......:| 
Zfish   169 SSSMTIDVPINEMSHSLLGHNQLTTIDHSDL--------------------SAQLGLSLGGGSV- 212

  Fly   169 NSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKR 233
             |.||...:.....|.|.:          ::|..:....:|::...|:                 
Zfish   213 -SKSPDQPLSTTPSPSGSL----------QDEDMEDFRQKTMLVDSFA----------------- 249

  Fly   234 FHEMAEKDKQRYEAEMQNYVPP-------------------KGAVVG--RGKKRKQIKDPNAPKR 277
               ::|      .:..|..|||                   .||.:|  :|||:   ||||.|::
Zfish   250 ---VSE------PSPAQISVPPPVVRRVGGKPSMVPVATVDTGASLGVKKGKKK---KDPNEPQK 302

  Fly   278 SLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEY 342
            .:||:..|..|.:..:|..||....|:::|.:...|..:..|.||.|:...|..|..|.:.:..|
Zfish   303 PVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKDYLKALAAY 367

  Fly   343 ------KTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQH 384
                  |:|.::..|||:...||.:.|......||..:.:...:.||:
Zfish   368 RASQLSKSSSELEDSAPATPPSMPSPAPIHTPPAAPIRPRLTPITEQN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 7/69 (10%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
tox4aXP_001921001.2 PHA03369 <215..510 CDD:223061 53/240 (22%)
HMG-box 300..365 CDD:238037 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.