DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmgb3b

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001017769.1 Gene:hmgb3b / 550466 ZFINID:ZDB-GENE-050417-290 Length:198 Species:Danio rerio


Alignment Length:218 Identity:100/218 - (45%)
Similarity:136/218 - (62%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 KAD-AKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKD 241
            |.| .||:|:|:||||||:||||||.||:|..||.|:|||:||:||||||..|||.:|.::|::|
Zfish     3 KGDPGKPKGKMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQD 67

  Fly   242 KQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIA 306
            |.||:.||.:|.|.|       |.|||.||||||:|..|.||.||.::|..:||.||..|:||:|
Zfish    68 KARYDQEMMHYNPGK-------KGRKQKKDPNAPRRPPSGFFLFCAEQRPIIKAQNPSLGIGDVA 125

  Fly   307 KELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAA 371
            |:||..|:::....||.:.|.|::.|.:|:::|..|:..|    |..|..|..:.:         
Zfish   126 KKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDMAFYRKKG----SGGSSSAKSEPK--------- 177

  Fly   372 AAQQQHQQLEEQHDDDDGDGDDD 394
              .......||:.||||.|.|||
Zfish   178 --DDDDDDDEEEEDDDDDDEDDD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 44/69 (64%)
HMGB-UBF_HMG-box 275..339 CDD:238686 26/63 (41%)
hmgb3bNP_001017769.1 HMG_box_2 7..78 CDD:286146 44/70 (63%)
HMG_box 94..161 CDD:278906 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583916
Domainoid 1 1.000 117 1.000 Domainoid score I5857
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3548
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm24274
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.