DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Ubtfl1

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001028965.1 Gene:Ubtfl1 / 546118 MGIID:3588290 Length:394 Species:Mus musculus


Alignment Length:149 Identity:35/149 - (23%)
Similarity:69/149 - (46%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 EHKKKHPD---ETVIFAEFS-RKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVV 260
            |.||...|   ..|.|..|| ..|.::|.. :....::|..:.|..::           .|.:..
Mouse    33 EFKKSQADLNWSKVAFGLFSGEMCKQKWME-ISYNLRKFRTLTELVQE-----------AKFSFT 85

  Fly   261 GRGKKRKQIKD-PNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKY 324
            .:..|.|.:.: |:.|||.|:|:..|..::|.|...:.|::....:.|.|..|:..:..|:||:|
Mouse    86 KKTHKNKILTEHPDRPKRPLTAYLRFYKEQRAKYCQMYPKYSNAQLTKILAEKYRQLPAEIKQRY 150

  Fly   325 ESMAERDKARYEREMTEYK 343
            ....:::|..::::|.::|
Mouse   151 IMDFKKEKEDFQKKMRQFK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 12/55 (22%)
HMGB-UBF_HMG-box 275..339 CDD:238686 17/63 (27%)
Ubtfl1NP_001028965.1 HMGB-UBF_HMG-box 101..166 CDD:238686 17/64 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..197 1/3 (33%)
HMGB-UBF_HMG-box 226..288 CDD:238686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.