DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Ubtfl1

DIOPT Version :10

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001028965.1 Gene:Ubtfl1 / 546118 MGIID:3588290 Length:394 Species:Mus musculus


Alignment Length:149 Identity:35/149 - (23%)
Similarity:69/149 - (46%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 EHKKKHPD---ETVIFAEFS-RKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVV 260
            |.||...|   ..|.|..|| ..|.::|.. :....::|..:.|..::           .|.:..
Mouse    33 EFKKSQADLNWSKVAFGLFSGEMCKQKWME-ISYNLRKFRTLTELVQE-----------AKFSFT 85

  Fly   261 GRGKKRKQIKD-PNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKY 324
            .:..|.|.:.: |:.|||.|:|:..|..::|.|...:.|::....:.|.|..|:..:..|:||:|
Mouse    86 KKTHKNKILTEHPDRPKRPLTAYLRFYKEQRAKYCQMYPKYSNAQLTKILAEKYRQLPAEIKQRY 150

  Fly   325 ESMAERDKARYEREMTEYK 343
            ....:::|..::::|.::|
Mouse   151 IMDFKKEKEDFQKKMRQFK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box_HMGB_rpt1 182..250 CDD:438794 12/53 (23%)
HMG-box_NHP6-like 262..342 CDD:438792 21/80 (26%)
Ubtfl1NP_001028965.1 HMG-box_UBF1_rpt1-like 98..173 CDD:438814 20/72 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..197 1/3 (33%)
HMG-box_UBF1_rpt6-like 222..306 CDD:438819
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..394
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.