DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and RGD1559962

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_008756867.1 Gene:RGD1559962 / 498988 RGDID:1559962 Length:209 Species:Rattus norvegicus


Alignment Length:216 Identity:101/216 - (46%)
Similarity:141/216 - (65%) Gaps:17/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|::||:||||||||||.||||.:|.|||||:||:||||||..|||.:|.::|:.||.||:
  Rat     8 KPRGKMSSYAFFVQTCREEHKNKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYD 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:|||||||.  .:|||    ||||||||..||||.||::.|.|:|:.:|...:||.||:||.
  Rat    73 REMKNYVPPKGD--KKGKK----KDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGK--IAMSAPSMQASMQAQAQKAALLAAAAQ 374
            .||:...:.||.||..|.:.|..||:::..|:..||  :....|......:.:.:         .
  Rat   132 MWSEQSAKDKQPYEQKAAKLKEEYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNE---------P 187

  Fly   375 QQHQQLEEQHDDDDGDGDDDE 395
            :..::.||:.|:|:.:.|:||
  Rat   188 EDEEEEEEEDDEDEEEEDEDE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 46/69 (67%)
HMGB-UBF_HMG-box 275..339 CDD:238686 29/63 (46%)
RGD1559962XP_008756867.1 HMG-box 7..78 CDD:294061 46/69 (67%)
HMG_box 95..162 CDD:278906 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5799
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3551
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm45117
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.