DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and RGD1561694

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038948739.1 Gene:RGD1561694 / 498388 RGDID:1561694 Length:209 Species:Rattus norvegicus


Alignment Length:218 Identity:100/218 - (45%)
Similarity:143/218 - (65%) Gaps:21/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|:.||:|||||||||||||||.:|.|||||:||:||||||..|||.:|.::|:.||.||:
  Rat     8 KPRGKMSLYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYD 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:|||||||     .||.|: ||||||||..||||.||::.|.|:|:.:|...:||.||:||.
  Rat    73 REMKNYVPPKG-----NKKGKK-KDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGK--IAMSAPSMQASMQAQAQKAALLAAAAQ 374
            .||:...:.||.||..|.:.|.:||:::..|:..||  :....|...             ..:.:
  Rat   132 MWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRP-------------TGSKK 183

  Fly   375 QQHQQLEEQHDDDDGDGDDDENQ 397
            :...:.||:.:::||:.:::|::
  Rat   184 KNEPEDEEEEEEEDGEDEEEEDE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 47/69 (68%)
HMGB-UBF_HMG-box 275..339 CDD:238686 29/63 (46%)
RGD1561694XP_038948739.1 HMG_box_2 6..78 CDD:401091 47/69 (68%)
HMG_box 95..162 CDD:395407 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5799
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3551
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm45117
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.