DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmgb2b

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001004674.1 Gene:hmgb2b / 447936 ZFINID:ZDB-GENE-040912-122 Length:214 Species:Danio rerio


Alignment Length:221 Identity:92/221 - (41%)
Similarity:139/221 - (62%) Gaps:11/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VKADA-KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEK 240
            ||.|. ||:|:.:|||:||||||:|||:|.||..|.|:|||:||:||||::...:|.:|.:||:.
Zfish     2 VKGDVNKPKGKTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKA 66

  Fly   241 DKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDI 305
            ||.||:.||:.||||||.    ||..::.||||||||..||||.||::.|..||:.:|...:|:|
Zfish    67 DKVRYDREMKTYVPPKGV----GKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEI 127

  Fly   306 AKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLA 370
            ||:||..||....:.:..:|..|.:.:.:||:|:..|:..|..:...|........::|      
Zfish   128 AKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRGPGRPTGSVKKSQ------ 186

  Fly   371 AAAQQQHQQLEEQHDDDDGDGDDDEN 396
            |.|.....:.|::.|::|.:.::||:
Zfish   187 AEADDDDDEDEDEEDEEDDEEEEDED 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 39/69 (57%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)
hmgb2bNP_001004674.1 HMG_box_2 7..78 CDD:286146 39/70 (56%)
HMG_box 97..164 CDD:278906 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583918
Domainoid 1 1.000 74 1.000 Domainoid score I9073
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3548
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm24274
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.