powered by:
Protein Alignment Dsp1 and tHMG2
DIOPT Version :9
Sequence 1: | NP_001138203.1 |
Gene: | Dsp1 / 117294 |
FlyBaseID: | FBgn0278608 |
Length: | 397 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 40/73 - (54%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 AKPRGRMTAYAYFV-QTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQR 244
|:|:..|:|:..:: .|.|:..:.:|||.:| .|.|.|..|.|:.|.|:.|..:.|.|.|....
Fly 7 ARPKKPMSAFMLWMNSTGRKNIRAEHPDFSV--QEVSVKGGEMWRAMADEHKIVWQESASKAMAE 69
Fly 245 YEAEMQNY 252
|:.:::.:
Fly 70 YKEKLEKW 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.