DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Ssrp

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster


Alignment Length:289 Identity:63/289 - (21%)
Similarity:105/289 - (36%) Gaps:74/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGR 186
            |:.:.||..|......:::::........:....:..:..:.:.:|.....  |.|::|:.....
  Fly   445 NENEPDAYLARLKAEAREKEEDDDDGDSDEESTDEDFKPNENESDVAEEYD--SNVESDSDDDSD 507

  Fly   187 MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQN 251
            .:.........:::.:||                        .|||...|...|:|:|.:     
  Fly   508 ASGGGGDSDGAKKKKEKK------------------------SEKKEKKEKKHKEKERTK----- 543

  Fly   252 YVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDV 316
                        |..|:.||...|||:.:||..:.||.|..:|..||...|.:|||:.|..|.::
  Fly   544 ------------KPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKEL 596

  Fly   317 DPEVKQKYESMAERDKARYEREMTEYK----------TSGKIAMS-----APSMQASMQAQAQKA 366
              :.|.|:|..|.:||.||..||..||          ..||.:..     :||.:|:......|:
  Fly   597 --KDKSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKTEPSPSKKANTSGSGFKS 659

  Fly   367 ALLAAAAQQQHQQLEEQHDDDDGDGDDDE 395
                          :|...|||....|||
  Fly   660 --------------KEYISDDDSTSSDDE 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 9/69 (13%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)
SsrpNP_523830.2 POB3 20..499 CDD:227494 6/55 (11%)
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 25/64 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.