DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HmgD

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster


Alignment Length:123 Identity:35/123 - (28%)
Similarity:61/123 - (49%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREM 339
            |||.|||:..:.|..|..:|..||...|.::||..|..|..:  :.|.::|:.|.:.|..|:|.:
  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDRAV 67

  Fly   340 TEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDDDDGDGDDDENQ 397
            .|::.:|          .|..|....|...|..|::..::.:::..|:|   ||||::
  Fly    68 KEFEANG----------GSSAANGGGAKKRAKPAKKVAKKSKKEESDED---DDDESE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 22/63 (35%)
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 22/64 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - P PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.