DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Hmg-2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster


Alignment Length:156 Identity:36/156 - (23%)
Similarity:68/156 - (43%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 PKG----AVVGRGKKR---KQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRK 312
            |||    :.:|...|:   ::|....|||..|:.:..|.||.|.:::...|:....:..:.:|.:
  Fly    49 PKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEE 113

  Fly   313 WSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKA----------- 366
            |..:..|.|..|...|.:|||.|:.::..:      ....|.:.|:..|:|:||           
  Fly   114 WHQLPEERKLPYIEAAAKDKAIYQEQLQMF------LKEHPEIVANELAKAKKATKLDGSPKEKT 172

  Fly   367 ----ALLAAAAQQQHQQLEEQHDDDD 388
                :.|..|.:.:.:.::.|.:|.|
  Fly   173 PKGESALGKAKKTKAKPVKRQSEDPD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.