DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tox

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001102124.1 Gene:Tox / 362481 RGDID:1310455 Length:525 Species:Rattus norvegicus


Alignment Length:330 Identity:75/330 - (22%)
Similarity:116/330 - (35%) Gaps:88/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQ 149
            :..||..|..|.....:::.........|:|  ||:..|       .|.::.:.|....:||...
  Rat   118 ITVSNMLGQDGTLLSNSISVMQEIGNAEGAQ--YSSHPQ-------LAAMRPRGQPTDLRQQASM 173

  Fly   150 QQHQQQQQMQQQQQQQNV----------INSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKK 204
            .||.|...:.|.|....:          .||.||.....|...|...:                 
  Rat   174 MQHGQLTTINQSQLSAQLGLNMGGTNVPHNSPSPPGSKSATPSPSSSV----------------- 221

  Fly   205 HPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQI 269
            |.||          |.:..| :...||:...:|.:|.|           .||       ||:|  
  Rat   222 HEDE----------CEDTSK-INGGEKRPASDMGKKPK-----------TPK-------KKKK-- 255

  Fly   270 KDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKAR 334
            ||||.|::.:||:..|..|.:..:|..||....|:::|.:...|..:..|.||.|:...|..|..
  Rat   256 KDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKE 320

  Fly   335 YEREMTEYKTS-----------------GKIAMSAPSMQASMQAQAQKAALLAAAAQQQ---HQQ 379
            |.:::..|:.|                 .::..|.||:... .:||..|..|::...||   ..|
  Rat   321 YLKQLAAYRASLVSKSYNDPVDVKTSQPPQLVNSKPSVFHG-PSQAHSALYLSSHYHQQPGMTPQ 384

  Fly   380 LEEQH 384
            |...|
  Rat   385 LTAMH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 11/69 (16%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
ToxNP_001102124.1 NHP6B <257..>360 CDD:227935 26/102 (25%)
HMG-box 261..>310 CDD:238037 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.