DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmg20a

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001082803.1 Gene:hmg20a / 326908 ZFINID:ZDB-GENE-030131-5107 Length:291 Species:Danio rerio


Alignment Length:130 Identity:37/130 - (28%)
Similarity:70/130 - (53%) Gaps:4/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 PKGAVVGRGKKRKQ-IKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDP 318
            |:.:...:|::||: :||.||||..|:.:..|.|:.|.:::|..|:....:|.:.||.:||.:..
Zfish    24 PRRSSWTKGRRRKKPLKDSNAPKAPLTGYVRFMNERREQLRAERPDVPFPEITRMLGNEWSKLPA 88

  Fly   319 EVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQ 383
            :.||:|...|::||.||.||:.:|:.:......:..:|...:.:..:.   .|..|...:.|.|:
Zfish    89 DEKQRYLDEADKDKERYMRELEQYQKTEAYKHFSRKVQEKQKGKRHRG---DAGRQAPGESLHEK 150

  Fly   384  383
            Zfish   151  150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 22/63 (35%)
hmg20aNP_001082803.1 HMGB-UBF_HMG-box 45..110 CDD:238686 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.