DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmgb1a

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_955849.2 Gene:hmgb1a / 321622 ZFINID:ZDB-GENE-030131-341 Length:205 Species:Danio rerio


Alignment Length:221 Identity:110/221 - (49%)
Similarity:143/221 - (64%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 KADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDK 242
            |...||||:|::|||||||||||||||||:.||.|:|||:||:||||||..|||.:|.:||:.||
Zfish     3 KDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDK 67

  Fly   243 QRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAK 307
            .|||.||:||:|||      |:|:|:.||||||||..||||.||::.|.|||...|...:||:||
Zfish    68 ARYEREMKNYIPPK------GEKKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLSIGDVAK 126

  Fly   308 ELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKI---AMSAPSMQASMQAQAQKAALL 369
            .||..|:.:..|.||.||..|.:.|.:||:::..|::.||:   |..|||....           
Zfish   127 RLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRSKGKVGGGAAKAPSKPDK----------- 180

  Fly   370 AAAAQQQHQQLEEQHDDDDGDGDDDE 395
             |..:.:....||..||||.:.:|||
Zfish   181 -ANDEDEDDDEEEDEDDDDEEEEDDE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 49/69 (71%)
HMGB-UBF_HMG-box 275..339 CDD:238686 30/63 (48%)
hmgb1aNP_955849.2 HMG-box 7..77 CDD:320749 49/69 (71%)
HMG_box 94..161 CDD:278906 30/66 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5857
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3548
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm24274
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - LDO PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.990

Return to query results.
Submit another query.