DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Bap111

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_572530.1 Gene:Bap111 / 31846 FlyBaseID:FBgn0030093 Length:749 Species:Drosophila melanogaster


Alignment Length:155 Identity:38/155 - (24%)
Similarity:67/155 - (43%) Gaps:24/155 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 YVPPKGAVVGRGKKRKQI---KDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKW 313
            :.|.|.......|.:.:.   |.|..|::.:..:..:.....:.|||.:||..:.::.|::|..|
  Fly    63 FTPQKVTKSSSSKNQNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELGKKIGAMW 127

  Fly   314 SDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQ--------KAALLA 370
            . :.|| .:|.|.:.|     ||.|..||:.|.|.....|:.||.|.|:::        :.....
  Fly   128 K-LLPE-DEKTEFIDE-----YEAEKLEYEKSLKAYHQTPAYQAYMSAKSKVKTDVDMHETPSRG 185

  Fly   371 AAAQQQH------QQLEEQHDDDDG 389
            ..::.||      |..|::.|.|:|
  Fly   186 GGSKSQHERRIDIQPAEDEDDQDEG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 38/155 (25%)
HMGB-UBF_HMG-box 275..339 CDD:238686 16/63 (25%)
Bap111NP_572530.1 HMGB-UBF_HMG-box 95..154 CDD:238686 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.