DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Hmg20a

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006243179.1 Gene:Hmg20a / 315689 RGDID:1564760 Length:350 Species:Rattus norvegicus


Alignment Length:147 Identity:51/147 - (34%)
Similarity:78/147 - (53%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 AEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQ-IKDPNAPKRSLSAFFWFCNDERNKVKALNPEFG 301
            ||..:||.|.|.::    |.....:|:|||: ::|.||||..|:.:..|.|:.|.:::|..||..
  Rat    72 AEGSEQRPEDEQRS----KRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVP 132

  Fly   302 VGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEY-KTSGKIAMSAPSMQASMQAQAQK 365
            ..:|.:.||.:||.:.||.||:|...|:|||.||.:|:.:| ||......|    :.:...|..|
  Rat   133 FPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFS----RKTQDRQKGK 193

  Fly   366 AALLAAAAQQQHQQLEE 382
            :....||.|..|...:|
  Rat   194 SHRQDAARQATHDHEKE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 6/13 (46%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)
Hmg20aXP_006243179.1 HMGB-UBF_HMG-box 106..171 CDD:238686 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.