DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMGB3

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001288160.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:220 Species:Homo sapiens


Alignment Length:214 Identity:96/214 - (44%)
Similarity:140/214 - (65%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||:|:|:|||:||||||||||||:|:..|.|||||:||:||||||..|||.:|.|||:.||.||:
Human    28 KPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYD 92

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||::|.|.||     |||:   ||||||||..|.||.||::.|.|:|:.||...:||:||:||.
Human    93 REMKDYGPAKG-----GKKK---KDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGE 149

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQ 376
            .|::::...||.|.:.|.:.|.:||:::.:||:.||.             ...|.....|..:.:
Human   150 MWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKF-------------DGAKGPAKVARKKVE 201

  Fly   377 HQQLEEQHDDDDGDGDDDE 395
            .:..||:.::::.:.::||
Human   202 EEDEEEEEEEEEEEEEEDE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 47/69 (68%)
HMGB-UBF_HMG-box 275..339 CDD:238686 27/63 (43%)
HMGB3NP_001288160.1 HMG_box_2 33..98 CDD:370242 44/64 (69%)
HMG_box 113..180 CDD:366139 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149771
Domainoid 1 1.000 117 1.000 Domainoid score I5909
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3638
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm40983
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.