DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMGB2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001124160.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:214 Identity:103/214 - (48%)
Similarity:142/214 - (66%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|::||:|||||||||||||||.:|.|||||:||:||||||..|||.:|.:||:.||.||:
Human     8 KPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYD 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:|||||||.  .:|||    ||||||||..||||.||::.|.|:|:.:|...:||.||:||.
Human    73 REMKNYVPPKGD--KKGKK----KDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQ 376
            .||:...:.||.||..|.:.|.:||:::..|:..||       .:|..:...:..........:.
Human   132 MWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGK-------SEAGKKGPGRPTGSKKKNEPED 189

  Fly   377 HQQLEEQHDDDDGDGDDDE 395
            .::.||:.|:|:.:.|:||
Human   190 EEEEEEEEDEDEEEEDEDE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 48/69 (70%)
HMGB-UBF_HMG-box 275..339 CDD:238686 29/63 (46%)
HMGB2NP_001124160.1 HMG_box_2 6..78 CDD:401091 48/69 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 54/103 (52%)
HMG_box 95..162 CDD:395407 29/66 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 11/54 (20%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5909
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37582
Inparanoid 1 1.050 213 1.000 Inparanoid score I3638
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm40983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.990

Return to query results.
Submit another query.