DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMGB1

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001300821.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:214 Identity:98/214 - (45%)
Similarity:146/214 - (68%) Gaps:6/214 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|::||:|||||||||||||||.:|.|:|||:||:||||||..|||.:|.:||:.||.|||
Human     8 KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYE 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:.|:|||      |:.:|:.||||||||..||||.||::.|.|:|..:|...:||:||:||.
Human    73 REMKTYIPPK------GETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQ 376
            .|::...:.||.||..|.:.|.:||:::..|:..||...:...:..:.:::.:|........::.
Human   132 MWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEED 196

  Fly   377 HQQLEEQHDDDDGDGDDDE 395
            .::.|::.|:|:.:.||||
Human   197 EEEEEDEEDEDEEEDDDDE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 48/69 (70%)
HMGB-UBF_HMG-box 275..339 CDD:238686 28/63 (44%)
HMGB1NP_001300821.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 60/94 (64%)
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P10103 1..10 1/1 (100%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15 5/6 (83%)
HMG_box_2 6..78 CDD:401091 48/69 (70%)
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43 11/15 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 10/24 (42%)
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96 10/21 (48%)
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108 14/18 (78%)
HMG_box 95..162 CDD:395407 28/66 (42%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183 6/32 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215 9/53 (17%)
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5909
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3638
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm40983
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - LDO PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.