DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tox2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001359507.1 Gene:Tox2 / 269389 MGIID:3611233 Length:541 Species:Mus musculus


Alignment Length:223 Identity:50/223 - (22%)
Similarity:80/223 - (35%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKC 219
            |.|:..|...::.|...||        .|.|..:|......:.:||....|           .|.
Mouse   199 QSQLISQMGIRSGIAHGSP--------SPPGSKSATPSPSSSTQEEESDAH-----------FKI 244

  Fly   220 AERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFW 284
            :...:..||..||                            .:..|:|:.||||.|::.:||:..
Mouse   245 SGEKRPSVDPGKK----------------------------AKNPKKKKKKDPNEPQKPVSAYAL 281

  Fly   285 FCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 349
            |..|.:..:|..||....||::|.:...|..:..|.||.|:...|..|..|.:.:..|:.| .::
Mouse   282 FFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRAS-LVS 345

  Fly   350 MSAPSMQASMQAQAQKAALLAAAAQQQH 377
            .|.|....:...||...|.:....|..:
Mouse   346 KSPPDQGEAKNTQANPPAKMLPPKQPMY 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 11/69 (16%)
HMGB-UBF_HMG-box 275..339 CDD:238686 19/63 (30%)
Tox2NP_001359507.1 HMG-box 272..337 CDD:238037 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.