DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tox4

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_075923.2 Gene:Tox4 / 268741 MGIID:1915389 Length:619 Species:Mus musculus


Alignment Length:130 Identity:36/130 - (27%)
Similarity:60/130 - (46%) Gaps:1/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 HEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPE 299
            ||....|.:|.....:..|...|......||||: ||||.|::.:||:..|..|.:..:|..||.
Mouse   184 HEDGVDDFRRQLPAQKTVVVETGKKQKAPKKRKK-KDPNEPQKPVSAYALFFRDTQAAIKGQNPN 247

  Fly   300 FGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQ 364
            ...|:::|.:...|..:..|.||.|:...|..|..|.:.:..||.:.:...:..:::.....|:|
Mouse   248 ATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQATVETVELDPVPQSQ 312

  Fly   365  364
            Mouse   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 4/16 (25%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
Tox4NP_075923.2 NHP6B 140..>306 CDD:227935 34/122 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 15/43 (35%)
Nuclear localization signal. /evidence=ECO:0000255 213..218 4/5 (80%)
HMG-box 223..288 CDD:238037 18/64 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..335 2/7 (29%)
PHA03160 <464..530 CDD:165431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.