DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and cmb1

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_593693.1 Gene:cmb1 / 2543595 PomBaseID:SPAC4G9.11c Length:223 Species:Schizosaccharomyces pombe


Alignment Length:161 Identity:37/161 - (22%)
Similarity:67/161 - (41%) Gaps:37/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 REEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEM----------AEKDKQRYEAEMQNY 252
            |:::|....||   ..::..|..|::    |.|||||.|.          :|..::..||.    
pombe    79 RQKYKALTADE---IQKYKNKLQEQF----DAEKKRFMETLRSFTPTEIDSENRRRSKEAH---- 132

  Fly   253 VPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKEL-------G 310
                    ..|.:..:::.|:.||:..|||..|..:.||..| |..|.|:.:....|       .
pombe   133 --------STGSRYYRLRHPDVPKKPSSAFILFYKELRNNPK-LRQELGIPEAISTLVEETQNAS 188

  Fly   311 RKWSDVDPEVKQKYESMAERDKARYEREMTE 341
            :.|.::..:.|:.:...::..|.:|::.|.|
pombe   189 KAWKELAEDKKKPFIDKSKALKEQYDKFMKE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 16/63 (25%)
HMGB-UBF_HMG-box 275..339 CDD:238686 17/70 (24%)
cmb1NP_593693.1 NHP6B 1..220 CDD:227935 37/161 (23%)
HMGB-UBF_HMG-box 147..218 CDD:238686 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.