DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tox

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001364007.1 Gene:Tox / 252838 MGIID:2181659 Length:526 Species:Mus musculus


Alignment Length:337 Identity:78/337 - (23%)
Similarity:117/337 - (34%) Gaps:84/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NPATTMAQVVATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQ-------GQVDANTAAQ 133
            :|.|.....:..||..|..|.....:::.........|:|  ||:..|       ||     ...
Mouse   109 HPQTMDLPEITVSNMLGQDGALLSNSISVMQEIGNAEGAQ--YSSHPQMAAMRPRGQ-----PTD 166

  Fly   134 LQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVI-NSASPMSRVKADAKPRGRMTAYAYFVQTC 197
            ::.|....|..|.....|.|...|:.......||. ||.||.....|...|...:          
Mouse   167 IRQQASMMQPGQLTTINQSQLSAQLGLNMGGTNVAHNSPSPPGSKSATPSPSSSV---------- 221

  Fly   198 REEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGR 262
                   |.||          |.:..| :...||:...:|.:|.|           .||      
Mouse   222 -------HEDE----------CEDASK-INGGEKRPASDMGKKPK-----------TPK------ 251

  Fly   263 GKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESM 327
             ||:|  ||||.|::.:||:..|..|.:..:|..||....|:::|.:...|..:..|.||.|:..
Mouse   252 -KKKK--KDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKK 313

  Fly   328 AERDKARYEREMTEYKTS-----------------GKIAMSAPSMQASMQAQAQKAALLAAAAQQ 375
            .|..|..|.:::..|:.|                 .::..|.||:... .:||..|..|::...|
Mouse   314 TEAAKKEYLKQLAAYRASLVSKSYTDPVDVKTSQPPQLVNSKPSVFHG-PSQAHSALYLSSHYHQ 377

  Fly   376 Q---HQQLEEQH 384
            |   ..||...|
Mouse   378 QPGMTPQLTAMH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 11/69 (16%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
ToxNP_001364007.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..264 28/117 (24%)
Nuclear localization signal. /evidence=ECO:0000255 237..256 9/38 (24%)
NHP6B <257..>360 CDD:227935 26/102 (25%)
HMG-box 261..>310 CDD:238037 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.