DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tox3

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_766501.2 Gene:Tox3 / 244579 MGIID:3039593 Length:575 Species:Mus musculus


Alignment Length:178 Identity:51/178 - (28%)
Similarity:62/178 - (34%) Gaps:89/178 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PTIDQQTIQH----YQQQLAAQQQQQVQQQQLQQHQV--VVQQNQQQAHQNSSNTTAGVGTQQLF 66
            |::  ||.||    .|||...||.||:|||||||||:  .:||..||.|               |
Mouse   433 PSV--QTQQHQMQLQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQH---------------F 480

  Fly    67 TYKMASSFPNPATTMAQVVATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQGQVDANTA 131
            .:.|.                                                            
Mouse   481 QHHMQ------------------------------------------------------------ 485

  Fly   132 AQLQHQQQQQQQQQQQQQQQHQQQQQMQQQ---QQQQNVINSASPMSR 176
               ||.||||||..|||..|.|.|||:||.   ||.|::.:.:.|..|
Mouse   486 ---QHLQQQQQQHLQQQLSQQQLQQQLQQHLQLQQLQHMQHQSQPSPR 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686
Tox3NP_766501.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258
HMG-box 254..319 CDD:238037
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..575 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.