DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tfam

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_033386.1 Gene:Tfam / 21780 MGIID:107810 Length:243 Species:Mus musculus


Alignment Length:177 Identity:44/177 - (24%)
Similarity:81/177 - (45%) Gaps:23/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEA 247
            |:..|::|..|......:.|.||||..:  :|..||.|..|:.:.:.|||.:....:.:.:.|:.
Mouse    49 PKKPMSSYLRFSTEQLPKFKAKHPDAKL--SELVRKIAALWRELPEAEKKVYEADFKAEWKAYKE 111

  Fly   248 EMQNY---VPPKGAVVGRGK-------------KRKQIKDPNAPKRSLSAFFWFCNDERNKVKAL 296
            .:..|   :.| ..::|..|             ||:::.....|||..||:..:.::...:.|  
Mouse   112 AVSKYKEQLTP-SQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAK-- 173

  Fly   297 NPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 343
             .:...|.: |.:...|.::.||.||.|..:|:.|:.||:.||..::
Mouse   174 -DDSAQGKL-KLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 18/68 (26%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
TfamNP_033386.1 HMG_box 49..116 CDD:278906 18/68 (26%)
HMGB-UBF_HMG-box 154..215 CDD:238686 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.