DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmg-6

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_493451.2 Gene:hmg-6 / 185946 WormBaseID:WBGene00009827 Length:128 Species:Caenorhabditis elegans


Alignment Length:92 Identity:23/92 - (25%)
Similarity:44/92 - (47%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFS 216
            :...:|:|:..|::..|.|.|                |||.|.:..:...|:..|..|  |.:.|
 Worm    34 NSNSRQIQEMDQKKKKIRSTS----------------AYALFFRERQSLEKRAAPYAT--FGQIS 80

  Fly   217 RKCAERWKTMVDKEKKRFHEMAEKDKQ 243
            :|.|.:|.::.::|||.:.:..||:::
 Worm    81 QKIARQWDSLTEEEKKAYKQRCEKNRK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 17/62 (27%)
HMGB-UBF_HMG-box 275..339 CDD:238686
hmg-6NP_493451.2 HMG-box 51..107 CDD:238037 19/73 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.