DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmg-1.2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:241 Identity:92/241 - (38%)
Similarity:131/241 - (54%) Gaps:43/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 QQHQQQQQMQQQQQQQNVINSASPMSRVKADAKP--RGRMTAYAYFVQTCREEHKKKHPDETVIF 212
            |.||.|........|      |:|...    .||  ||:.:.|.:||:.|.||||||:|:|.|..
 Worm    20 QSHQLQPNPSATMYQ------ATPRDM----GKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQV 74

  Fly   213 AEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKR 277
            .|.|:||:|:||||||.||:||:|:|:||.:||:||:.  |...|......|:::..|||:||||
 Worm    75 TEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVS--VAAYGGEDAMRKRKRAKKDPHAPKR 137

  Fly   278 SLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEY 342
            :|||||::..|:|.:::|.:|::.||.:|:|||:.|..|..|.|..||..|:.||.||..||..|
 Worm   138 ALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNY 202

  Fly   343 KTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDDDD 388
            |                             |:.|.....:.:|||:
 Worm   203 K-----------------------------AEMQKMSGMDHYDDDN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 40/71 (56%)
HMGB-UBF_HMG-box 275..339 CDD:238686 29/63 (46%)
hmg-1.2NP_001380090.1 HMGB-UBF_HMG-box 50..112 CDD:238686 36/61 (59%)
HMGB-UBF_HMG-box 135..200 CDD:238686 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161174
Domainoid 1 1.000 93 1.000 Domainoid score I4775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37582
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - oto19593
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - LDO PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.