DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmg-20

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_493178.1 Gene:hmg-20 / 173124 WormBaseID:WBGene00012209 Length:386 Species:Caenorhabditis elegans


Alignment Length:265 Identity:53/265 - (20%)
Similarity:105/265 - (39%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMSRVK-ADAKPRGRMTAY 190
            |:.|....:.......::.:.......:.:.:...::.||....::|..|.| |...|...::. 
 Worm     7 DSTTGPAAKSLPTSDVEEDEAAPDLKAESEDVTSSEEMQNKNPVSAPEKRAKTASFSPPPALSP- 70

  Fly   191 AYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPP 255
            |:.:|...||.:.|...::                  |:|:|:..::.||     .|:|.....|
 Worm    71 AHSIQMENEEIEVKMEVDS------------------DEEEKKLPKITEK-----RAKMVYKKKP 112

  Fly   256 KGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDER-NKVKALNPEFGVGDIAKELGRKWSDVDPE 319
            :     :.|:.....|||||||:.|.:..|....| :..||:..:   .:|...|...|..:..|
 Worm   113 E-----KEKEAVPFIDPNAPKRNRSGYVHFIIHRRASYSKAVMSQ---REINISLAADWQKLTAE 169

  Fly   320 VKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQ-QQHQQLEEQ 383
            .:..::..|:.:|.:|...|.|||.:          .:..:.|.::|..|::.:. .::.:...|
 Worm   170 ERIPFQQRADEEKVKYLELMEEYKKT----------DSHKEFQKKRAKFLSSQSNGSKNAKKRRQ 224

  Fly   384 HDDDD 388
            .|.||
 Worm   225 ADSDD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 13/69 (19%)
HMGB-UBF_HMG-box 275..339 CDD:238686 15/64 (23%)
hmg-20NP_493178.1 HMG 126..193 CDD:197700 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.