DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmg-20

DIOPT Version :10

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_493178.1 Gene:hmg-20 / 173124 WormBaseID:WBGene00012209 Length:386 Species:Caenorhabditis elegans


Alignment Length:163 Identity:36/163 - (22%)
Similarity:54/163 - (33%) Gaps:48/163 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNNKARILAGSKKTPRYIREVGLGF-----KAPRDAVEGTYIDKK-------------CPWAGNV 63
            ||:..||....|....|  |||:..     :..||.:.|....||             .|.|...
 Worm   601 LNDLFRISQSRKSNIAY--EVGVQMVEIYNEQVRDLLSGDSSQKKLGILSTTQQNGLAVPDASMY 663

  Fly    64 PIRG----MILTGVVLKNKMTRTIVVRRDYLHYIKKYRRYEKRHKNVPAHC--------SPAFRD 116
            |:..    :.|..:.|:|::..:..:.          .|..:.|..|..|.        |..:.:
 Worm   664 PVTSTSDVLELMSIGLQNRVVSSTALN----------ERSSRSHSIVTVHVRGKDLKTGSALYGN 718

  Fly   117 IHPGDLVTIGECRPLSKTVRFNVLK----VNKS 145
            :|..||.  |..|.....|..:.||    :|||
 Worm   719 LHLVDLA--GSERVDRSEVTGDRLKEAQHINKS 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box_HMGB_rpt1 182..250 CDD:438794
HMG-box_NHP6-like 262..342 CDD:438792
hmg-20NP_493178.1 HMG-box_SF 126..204 CDD:469606
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.