DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and hmg-3

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_491688.1 Gene:hmg-3 / 172250 WormBaseID:WBGene00001973 Length:689 Species:Caenorhabditis elegans


Alignment Length:290 Identity:77/290 - (26%)
Similarity:117/290 - (40%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YSAANQGQVDA-NTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPM------S 175
            |.::::..:|. .:..:.:.::|......:...:.:...:.|::|:..::....:...      |
 Worm   440 YGSSDEDDIDPYKSTVKAEGREQDDDSDDESTDEDYDLDKDMKKQKNDKDSSEGSGSEPDDEYDS 504

  Fly   176 RVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEK 240
            ..:.||...|                 :..|||..|          ..|....||||...|..||
 Worm   505 GSEKDASGTG-----------------ESDPDEENI----------EPKKKESKEKKNKREKKEK 542

  Fly   241 DKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAF-FWFCNDERNKVKALNPEFG--V 302
                         |.|...|.:|||   .||||.|||:.:|: .|| |..||.:|    |.|  :
 Worm   543 -------------PVKEKAVKKGKK---TKDPNEPKRATTAYIIWF-NANRNSMK----EDGDTL 586

  Fly   303 GDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTS--GKIAMSAPSMQASMQAQAQK 365
            ||:||:.|.||..:..:.|:::...|.:||||||.||.|||.:  |....|.||.:.|......|
 Worm   587 GDVAKKAGAKWKSMSADDKKEWNDKAAQDKARYEAEMKEYKKNGGGVEKASGPSTKKSSDQSPGK 651

  Fly   366 AALLAAAAQQQHQQLEEQHDDDDGDGDDDE 395
                        |...::|..|..|.||||
 Worm   652 ------------QFKSKEHISDTDDSDDDE 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 13/69 (19%)
HMGB-UBF_HMG-box 275..339 CDD:238686 27/66 (41%)
hmg-3NP_491688.1 POB3 20..497 CDD:227494 5/56 (9%)
SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051
HMGB-UBF_HMG-box 561..624 CDD:238686 28/67 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.