DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Hmg20b

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006513311.1 Gene:Hmg20b / 15353 MGIID:1341190 Length:415 Species:Mus musculus


Alignment Length:166 Identity:46/166 - (27%)
Similarity:77/166 - (46%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERN 291
            |.:|:.......||..|..|       |.|.....:|||||:|. ||.||..::.:..|.|:.|.
Mouse    30 VKQERSEGSRAGEKGPQEEE-------PVKKRGWPKGKKRKKIL-PNGPKAPVTGYVRFLNERRE 86

  Fly   292 KVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQ 356
            :::..:|:....:|.|.||.:||.:.|..||:|...||::|.:|.:|:..|:.|....:....:|
Mouse    87 QIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKIQ 151

  Fly   357 AS-MQAQAQKAALLAAAAQQQHQQLEEQHDDDDGDG 391
            .: ::.:...:.|:        ..|...|...|.||
Mouse   152 ENKIKKEDSSSGLM--------NTLLNGHKGVDCDG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 6/24 (25%)
HMGB-UBF_HMG-box 275..339 CDD:238686 20/63 (32%)
Hmg20bXP_006513311.1 HMGB-UBF_HMG-box 70..134 CDD:238686 20/63 (32%)
OmpH 190..>254 CDD:214922
FAM222A <314..>400 CDD:373691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.