DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMGB4

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001366230.1 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:175 Identity:62/175 - (35%)
Similarity:97/175 - (55%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||:..:::|.:|:...|.:.|::.|:..|.|.||||||:|:|:::...||.::..:|:.||.||:
Human     8 KPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQ 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||.||       ||:.|||:: :||..|:|..|:|..||.|...::|..||.:.|..:||..|:
Human    73 EEMMNY-------VGKRKKRRK-RDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGK 129

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYK----TSGKIAMSA 352
            .||......|..||......:|:|..|:..|:    ...|..|||
Human   130 MWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 26/69 (38%)
HMGB-UBF_HMG-box 275..339 CDD:238686 21/63 (33%)
HMGB4NP_001366230.1 HMG-box 8..78 CDD:412149 26/69 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 11/28 (39%)
HMG-box 93..158 CDD:238037 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.