DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and LOC108350839

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_017448593.1 Gene:LOC108350839 / 108350839 RGDID:11440908 Length:214 Species:Rattus norvegicus


Alignment Length:216 Identity:93/216 - (43%)
Similarity:141/216 - (65%) Gaps:19/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|:::|:|||||||||||||.:.:|.|:|||:||:||||||..|||.:|.:||:.||.|||
  Rat     8 KPRGKMSSHAFFVQTCREEHKKKHLNASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYE 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:.|:|||      |:.:|:.|||||.||..||||.||::.|.|:|..:|...:||:||:||.
  Rat    73 REMKTYIPPK------GETKKKFKDPNALKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQ 376
            .|::...:.||..|..|.:.|.:||:::..|:..||             ..|.|..::.|...::
  Rat   132 MWTNTAVDDKQPCEKKAAKLKEKYEKDIAAYRAKGK-------------PDAAKKGVVKAEKSKK 183

  Fly   377 HQQLEEQHDDDDGDGDDDENQ 397
            .::.|:..:|:|.:.:::||:
  Rat   184 KKEEEDDEEDEDEEEEEEENE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 45/69 (65%)
HMGB-UBF_HMG-box 275..339 CDD:238686 26/63 (41%)
LOC108350839XP_017448593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5799
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3551
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm45117
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - LDO PTHR48112
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.