DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMG20A

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001291433.1 Gene:HMG20A / 10363 HGNCID:5001 Length:347 Species:Homo sapiens


Alignment Length:147 Identity:51/147 - (34%)
Similarity:80/147 - (54%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 AEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQ-IKDPNAPKRSLSAFFWFCNDERNKVKALNPEFG 301
            ||.::||:|.|.::    |.....:|:|||: ::|.||||..|:.:..|.|:.|.:::|..||..
Human    69 AEGNEQRHEDEQRS----KRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVP 129

  Fly   302 VGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEY-KTSGKIAMSAPSMQASMQAQAQK 365
            ..:|.:.||.:||.:.||.||:|...|:|||.||.:|:.:| ||......|    :.:...|..|
Human   130 FPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFS----RKTQDRQKGK 190

  Fly   366 AALLAAAAQQQHQQLEE 382
            :....||.|..|...:|
Human   191 SHRQDAARQATHDHEKE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 6/13 (46%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)
HMG20ANP_001291433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 17/47 (36%)
DUF5401 <59..313 CDD:375164 51/147 (35%)
HMGB-UBF_HMG-box 103..168 CDD:238686 26/64 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..211 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.