DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and tox2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_004918576.1 Gene:tox2 / 100124824 XenbaseID:XB-GENE-982431 Length:507 Species:Xenopus tropicalis


Alignment Length:264 Identity:53/264 - (20%)
Similarity:96/264 - (36%) Gaps:65/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 AAQLQHQQQQQQQQQQQQQQQHQ-----------------QQQQMQQQQQQQNVINSASPMSRVK 178
            ::||...|:....:.......||                 .|.|:..|...::.:...||     
 Frog   132 SSQLPTIQELVHSEGSSYDPNHQVSLINRSGMLPSHMSALSQSQLVSQMGMRSAVTHGSP----- 191

  Fly   179 ADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQ 243
               .|.|..:|......:.:||..:.|                 :|..  .||:..:::.:|.| 
 Frog   192 ---SPPGSKSATPSPSSSTQEEETESH-----------------YKGA--GEKRPSNDLGKKPK- 233

  Fly   244 RYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKE 308
                               .:|:|:.||||.|::.:||:..|..|.:..:|..||....||::|.
 Frog   234 -------------------NQKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGDVSKI 279

  Fly   309 LGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAA 373
            :...|..:..|.||.|:...|..|..|.:.:..|:.| .::.|......:..:||.:|:.:....
 Frog   280 VASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRAS-LVSKSYSEQGDTKNSQANQASKMILPK 343

  Fly   374 QQQH 377
            |..:
 Frog   344 QSMY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 11/69 (16%)
HMGB-UBF_HMG-box 275..339 CDD:238686 19/63 (30%)
tox2XP_004918576.1 HMG-box 246..311 CDD:238037 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.