DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and tox4b

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001121758.1 Gene:tox4b / 100003353 ZFINID:ZDB-GENE-080220-49 Length:583 Species:Danio rerio


Alignment Length:111 Identity:35/111 - (31%)
Similarity:55/111 - (49%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 QNYVPPKGAVVGR----GKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELG 310
            |...|...||..|    |||.::.||||.|::.:||:..|..|.:..:|..||....|:::|.:.
Zfish   228 QPVFPASSAVPVRKPAGGKKGRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVA 292

  Fly   311 RKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQ 356
            ..|..:..|.||.|:..||..|..|.:.:..||..   .:|.|:::
Zfish   293 SMWDSLGEEQKQVYKRKAEAAKTEYLKALAAYKAE---QLSQPTIE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 1/1 (100%)
HMGB-UBF_HMG-box 275..339 CDD:238686 19/63 (30%)
tox4bNP_001121758.1 HMG-box 257..322 CDD:238037 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.