DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH2D1B and INPP5E

DIOPT Version :10

Sequence 1:NP_444512.2 Gene:SH2D1B / 117157 HGNCID:30416 Length:132 Species:Homo sapiens
Sequence 2:NP_648566.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster


Alignment Length:48 Identity:12/48 - (25%)
Similarity:19/48 - (39%) Gaps:3/48 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    64 RIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWR 111
            ||.::..||:....:...|.....|....:..|   |:...||.|:.|
  Fly    11 RITSSTSSPRSGHKTASSLFGLLSKRPSKVEPH---PVTPESPRLQQR 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH2D1BNP_444512.2 SH2_SAP1 1..103 CDD:198205 8/38 (21%)
INPP5ENP_648566.1 EEP 387..703 CDD:469791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.