DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CATSPER2 and bicdl1

DIOPT Version :9

Sequence 1:NP_001269239.1 Gene:CATSPER2 / 117155 HGNCID:18810 Length:534 Species:Homo sapiens
Sequence 2:XP_031757461.1 Gene:bicdl1 / 779781 XenbaseID:XB-GENE-5811431 Length:603 Species:Xenopus tropicalis


Alignment Length:234 Identity:50/234 - (21%)
Similarity:89/234 - (38%) Gaps:84/234 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   356 ELNEEMARREVQLKADMFKRQIIQRRKNMSHEALTSSHSKIEDRGASQQRESLDLSEVSEVESNY 420
            |.|::|:||..:::.:|..:  ::..:...||.    ..|:|:|....:      ..|||:||:.
 Frog    85 ERNQDMSRRYEEMQREMTDK--LEHLEQEKHEL----KRKLENREGEWE------GRVSELESDV 137

Human   421 GATEEDL-------------------------------ITSASKTEETLSK-----KREYQSSSC 449
            ...:|:|                               ::.|::.|..||:     :.|::..|.
 Frog   138 KLLQEELEKQQVNLREADREKLSVVQELSEQNQRLLEQLSRATEMERQLSQQVNVLQEEFREKSL 202

Human   450 VSSTSSSYSSSSESRFSESIGRL------------DWETLVHEN--LPGLMEMDQDDRV------ 494
               ::|.:.|..||..:|.|..:            ...|::.||  |.||:|..||..:      
 Frog   203 ---STSQHVSRLESLLAEQILEIKMLSDRKRELEQQLSTIMEENEQLQGLVEELQDKELSLNQQN 264

Human   495 WPRDSLFR------------YFELLEKLQYNLEERKKLQ 521
            :.:|...|            |.:|..||: .|.|.|.||
 Frog   265 FGKDLQLRESQLEIEEMRLSYRQLEGKLE-ELREEKSLQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CATSPER2NP_001269239.1 Ion_trans 178..356 CDD:278921 50/234 (21%)
bicdl1XP_031757461.1 SbcC <49..>533 CDD:223496 50/234 (21%)
SMC_prok_A <81..>300 CDD:274009 47/230 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.