DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CATSPER2 and cdknx

DIOPT Version :9

Sequence 1:NP_001269239.1 Gene:CATSPER2 / 117155 HGNCID:18810 Length:534 Species:Homo sapiens
Sequence 2:XP_002934672.1 Gene:cdknx / 100126686 XenbaseID:XB-GENE-1032978 Length:207 Species:Xenopus tropicalis


Alignment Length:64 Identity:13/64 - (20%)
Similarity:28/64 - (43%) Gaps:11/64 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   420 YGATEEDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLP 483
            :|..:.|.:.|..|.:     .:|.|:|.| ...:..:.|.:..:     |...||::..:::|
 Frog    33 FGPIDHDELRSELKRQ-----LKEIQASDC-QRWNFDFESGTPLK-----GIFCWESVESKDVP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CATSPER2NP_001269239.1 Ion_trans 178..356 CDD:278921
cdknxXP_002934672.1 CDI 31..77 CDD:366992 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.