powered by:
Protein Alignment CATSPER2 and cdknx
DIOPT Version :9
Sequence 1: | NP_001269239.1 |
Gene: | CATSPER2 / 117155 |
HGNCID: | 18810 |
Length: | 534 |
Species: | Homo sapiens |
Sequence 2: | XP_002934672.1 |
Gene: | cdknx / 100126686 |
XenbaseID: | XB-GENE-1032978 |
Length: | 207 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 13/64 - (20%) |
Similarity: | 28/64 - (43%) |
Gaps: | 11/64 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 420 YGATEEDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLP 483
:|..:.|.:.|..|.: .:|.|:|.| ...:..:.|.:..: |...||::..:::|
Frog 33 FGPIDHDELRSELKRQ-----LKEIQASDC-QRWNFDFESGTPLK-----GIFCWESVESKDVP 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CATSPER2 | NP_001269239.1 |
Ion_trans |
178..356 |
CDD:278921 |
|
cdknx | XP_002934672.1 |
CDI |
31..77 |
CDD:366992 |
10/54 (19%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2301 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
NCBI |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.