DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eif4e and eIF4EHP

DIOPT Version :9

Sequence 1:NP_446426.1 Gene:Eif4e / 117045 RGDID:69647 Length:217 Species:Rattus norvegicus
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:186 Identity:54/186 - (29%)
Similarity:91/186 - (48%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    13 NPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKT---WQANLRLISKFDTVEDFWA 74
            |.||.|....|:.             ||:.:.|||.:.:..:.   :..:|.::.:..:|:.:|:
  Fly    35 NLPPLEVGPGENR-------------LQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWS 86

  Rat    75 LYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIG 139
            ||:|:...:.|.|..:..|||.||.|||||..|.:||:|||.|    |::.:||.|....:.::|
  Fly    87 LYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRL----RKNKVDRAWENVCMAMLG 147

  Rat   140 ESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVI 195
            |.| ...|::||.|:..:.....|.:   .|.:|..:..|...:..:.| ..||:|
  Fly   148 EQF-LVGDEICGVVLQTKYPNPSIQV---ACSSRPIICIIYTRFVVQFG-KCKIII 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Eif4eNP_446426.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 5/13 (38%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000250|UniProtKB:P06730 37..40 0/2 (0%)
IF4E 38..197 CDD:396291 49/161 (30%)