DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptf1a and CG33557

DIOPT Version :9

Sequence 1:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:102 Identity:34/102 - (33%)
Similarity:49/102 - (48%) Gaps:28/102 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat   138 NGAAAAAAAAA--------------------RRRRRVRSEAELQQLRQAANVRERRRMQSINDAF 182
            :|:|:.:.|||                    ..|||        ..||..|.|||.|..::|.|:
  Fly    25 SGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRR--------PPRQKINARERYRTFNVNSAY 81

  Rat   183 EGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQ 219
            |.||:.|||.|..::|||::.:|||..||..||..::
  Fly    82 EALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.