DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptf1a and Fer1

DIOPT Version :9

Sequence 1:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:173 Identity:75/173 - (43%)
Similarity:96/173 - (55%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat   148 ARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYIN 212
            :.:.||::..:::.|.|||||:||||||||||:||||||:|||||||||||||||||:|||.||.
  Fly    72 SHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYIT 136

  Rat   213 FLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQ---------KVIICHRGTRSPSPSDP 268
            ||||:|:.|                   ..|:.||...|         |:|:          .|.
  Fly   137 FLSEMVKKD-------------------KNGNEPGLSLQRNYQKEPPKKIIL----------KDR 172

  Rat   269 DYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDPRKLNSK 311
            ..|:    .|||||. .|..:.......|:.|||||||..:|:
  Fly   173 TGGV----AHSLSWY-RKGDRYPGSKLYARTWTPEDPRGPHSQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 47/53 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326 4/8 (50%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340734
Domainoid 1 1.000 94 1.000 Domainoid score I7308
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4724
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269550at2759
OrthoFinder 1 1.000 - - FOG0008172
OrthoInspector 1 1.000 - - oto98244
orthoMCL 1 0.900 - - OOG6_108748
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.