DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ambp and Appl

DIOPT Version :9

Sequence 1:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus
Sequence 2:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster


Alignment Length:281 Identity:51/281 - (18%)
Similarity:86/281 - (30%) Gaps:96/281 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 LRTLFLLLTACLASRADPASTLPDIQVQENFSESRIY--------GKWY----NLAVGSTCPWLS 56
            ||:|:::| |...::...||...:.|:.......:||        |:|.    ....|.||    
  Fly    11 LRSLWVVL-AIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTC---- 70

Mouse    57 RIKDKM-------------SVSTLV-----------LQEGATETEISMTSTRWRRGVCEEITGAY 97
             ::|||             .::.:|           .::||........|.||.:..  ...|.:
  Fly    71 -LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPF--RCLGPF 132

Mouse    98 QKTDI---DGKFLYHKS---------KWNITLESYVVHTNYDEYAIFLTKKSSHHHGLTITAKLY 150
            |...:   :|....|..         :||                            .|..|...
  Fly   133 QSDALLVPEGCLFDHIHNASRCWPFVRWN----------------------------QTGAAACQ 169

Mouse   151 GREPQLRDSLLQEFKDVALNVGISENSIIFMPDRGECVPGDREVEPTSIARARRAVLPQESEGSG 215
            .|..|:|...:      .|..|||    :|......|.|...:.:...:.:....|:|.....|.
  Fly   170 ERGMQMRSFAM------LLPCGIS----VFSGVEFVCCPKHFKTDEIHVKKTDLPVMPAAQINSA 224

Mouse   216 TEPLITGTLKKEDSCQLNYSE 236
            .:.|:..  .::||...|||:
  Fly   225 NDELVMN--DEDDSNDSNYSK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmbpNP_031469.1 Lipocalin 41..185 CDD:278490 30/183 (16%)
Kunitz_BPTI 230..281 CDD:278443 3/7 (43%)
Kunitz_BPTI 285..337 CDD:278443
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 36/216 (17%)
APP_N 33..141 CDD:280358 19/114 (17%)
APP_Cu_bd 143..198 CDD:289676 14/92 (15%)
APP_E2 387..580 CDD:289677
GBP_C <629..682 CDD:303769
APP_amyloid 834..887 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.