DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alx4 and PHDP

DIOPT Version :9

Sequence 1:NP_031468.1 Gene:Alx4 / 11695 MGIID:108359 Length:399 Species:Mus musculus
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:159 Identity:63/159 - (39%)
Similarity:85/159 - (53%) Gaps:39/159 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse   131 SGGHNAALQVPCYAKESNLGEPELPPDSEPVGMDNSY-LSVKETGAKGPQDRASAEIPSPLE--- 191
            ||.:...|.|..:....||            .:|:|| |...|:..:|..::.|:.:.|.:.   
  Fly    26 SGANGGGLSVANHINHYNL------------MIDSSYKLCANESAIRGSLNQESSLLFSKITTVS 78

Mouse   192 ------------KTD-----------SESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYARE 233
                        .||           |.::|.|:||.||||||.||.||||:|.:|||||:|.||
  Fly    79 EFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTRE 143

Mouse   234 QLAMRTDLTEARVQVWFQNRRAKWRKRER 262
            ::|.:..||||||||||||||||:||:||
  Fly   144 EIASKLHLTEARVQVWFQNRRAKFRKQER 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alx4NP_031468.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..133 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..206 11/60 (18%)
Homeobox 206..258 CDD:278475 38/51 (75%)
OAR 375..392 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 379..392
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 38/51 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.