DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fgfrl1 and CG31431

DIOPT Version :9

Sequence 1:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus
Sequence 2:NP_001247231.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster


Alignment Length:335 Identity:80/335 - (23%)
Similarity:128/335 - (38%) Gaps:86/335 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   155 VIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKK-------------KWT----- 201
            :|.:..|..|:|:|...|        :.|:..|..::...:.|:             :||     
  Fly    40 LIQQRAGFDVKLQCNLKG--------LVDESMLNDIKIHWYFKQCSENNCHQLGSVDEWTALPCE 96

Mouse   202 -------LSLKNLKPEDSGKYTCRVS----NKAGAINA----TYKVDVIQRTRSKPVLTGTHPVN 251
                   |.|:|:....||.|.|.::    :||.|::.    ||::||...:.:.|....::|.|
  Fly    97 PSLCRPELWLRNVTERYSGLYKCSINPHIWDKAQAVDVQLVRTYQLDVKNTSLAAPEFVDSYPNN 161

Mouse   252 TTVDFGGTTSFQCKVRSDVKPVIQWLKRVEY-----GSEGR--------HNSTIDVGGQKFVVLP 303
            .|...|....|||:|.|:..|.|:|.:|..|     |.|..        .|..:...|:.:.:|.
  Fly   162 KTTLVGSRVVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTTSNFSNHIVRYNGRTYELLS 226

Mouse   304 TGDVWSRPDGSYLNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPD-------------- 354
            |..........||:||::...|..|||.|.|:..:..|:..|.|||.||.|              
  Fly   227 TDPEKMMAPQIYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFLDVLADVEDTDQENEYWSDY 291

Mouse   355 -PKPPGPPMASSSSSTSLPWPVVIGIPAGAVFILGTVLLWLCQTKKKPCAPASTLPVPGHRPPGT 418
             .:..|.|     :|....:.::..:|.|...:..||  |......|.|:       .||   |.
  Fly   292 GNEDEGVP-----TSDRREFLLLFLMPLGLALLPLTV--WFSYLLYKRCS-------VGH---GD 339

Mouse   419 SRERSGDKDL 428
            .:....|:||
  Fly   340 CQRIDSDEDL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fgfrl1NP_473412.1 I-set 29..112 CDD:369462
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151
Ig2_FGFRL1-like 153..234 CDD:143264 23/111 (21%)
Ig 257..351 CDD:386229 32/106 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 4/21 (19%)
CG31431NP_001247231.1 IG_like 159..274 CDD:214653 35/114 (31%)
Ig 167..275 CDD:299845 32/107 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833323
Domainoid 1 1.000 47 1.000 Domainoid score I11989
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19890
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.