DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jdp2 and kay

DIOPT Version :9

Sequence 1:XP_008762956.1 Gene:Jdp2 / 116674 RGDID:621611 Length:312 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:247 Identity:65/247 - (26%)
Similarity:97/247 - (39%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    79 GCAYITARRVLLPRALGSRGRGAPPDRDAAGTSAAGPGPVPQAEEREHRREEGAGGGGGEAPPGR 143
            |||.....:| ||.|:...|.|.|     .|.|:.   |:.|..:.       :.|.|.|:....
  Fly   278 GCAGFAVPKV-LPNAIDVLGMGIP-----TGVSSL---PLQQTFDL-------SLGQGSESEDSN 326

  Rat   144 PATPPAMM--------------------PGQIPDPSVTAGSLPGLGPLTGLPSSALTTEEL--KY 186
            .:.....|                    .|.|...||..|.:.....:....||:..:..:  ..
  Fly   327 ASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSN 391

  Rat   187 ADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQR 251
            |:..|..|....        |:||....:...|||::|..|||:||.||||||.::.::|..|..
  Fly   392 ANTSNTPARRGG--------GRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTE 448

  Rat   252 ESERLELMNAELKTQIEELKLERQQLILMLNRHRPTC-IVRTDSVRTPESEG 302
            |.|:||.....::.:||.|...:.||..:|..||.|| .:|:|.:......|
  Fly   449 EVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNG 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jdp2XP_008762956.1 PKc_like 167..>210 CDD:304357 6/44 (14%)
bZIP_ATF3 231..284 CDD:269870 20/52 (38%)
coiled coil 231..281 CDD:269870 19/49 (39%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 24/60 (40%)
coiled coil 421..480 CDD:269869 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.